The domain within your query sequence starts at position 4 and ends at position 158; the E-value for the FMN_red domain shown below is 2e-14.
KKVLIVYAHQEPKSFNGSLKKVAVEELSKQGCTVTVSDLYSMNFEPRATRNDITGAPSNP DVFSYGIETHEAYKKKALTSDIFEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCR GFAFDIPGFYDSGFLKGKLALLSLTTGGTAEMYTK
FMN_red |
![]() |
---|
PFAM accession number: | PF03358 |
---|---|
Interpro abstract (IPR005025): | This domain in found in several flavoproteins such as FMN-dependent NADPH-azoreductase, which catalyses the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines [ (PUBMED:16752898) ], and NAD(P)H:quinone oxidoreductase, which reduces quinones to the hydroquinone state to prevent interaction of the semiquinone with O2 and production of superoxide [ (PUBMED:9694845) ]. In Arabidopsis NADPH:quinone oxidoreductase is involved in detoxification pathways [ (PUBMED:10606758) ]. NAD(P)H:quinone oxidoreductase prefers NADH over NADPH, while FMN-dependent NADPH-azoreductase requires NADPH, but not NADH, as an electron donor for its activity. Other proteins with this domain include iron-sulfur flavoproteins [ (PUBMED:11591665) ] and chromate reductase [ (PUBMED:14766567) ]. |
GO function: | oxidoreductase activity (GO:0016491) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FMN_red