The domain within your query sequence starts at position 2 and ends at position 209; the E-value for the FMO-like domain shown below is 9.3e-122.
VKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSSDLGGLWRFTEHVEEGRASLYKSVVSN SSREMSCYPDFPFPEDYPNFVPNSLFLEYLKLYSTQFNLQRCIYFNTKVCSITKRPDFAV SGQWEVVTVTNGKQNSAIFDAVMVCTGFLTNPHLPLDSFPGILTFKGEYFHSRQYKHPDI FKDKRVLVVGMGNSGTDIAVEASHLAKK
FMO-like |
![]() |
---|
PFAM accession number: | PF00743 |
---|---|
Interpro abstract (IPR020946): | Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [ (PUBMED:8311461) ]. Using an NADPH cofactor and FAD prosthetic group, these microsomal proteins catalyse the oxygenation of nucleophilic nitrogen, sulphur, phosphorus and selenium atoms in a range of structurally diverse compounds. FMOs have been implicated in the metabolism of a number of pharmaceuticals, pesticides and toxicants. In man, lack of hepatic FMO-catalysed trimethylamine metabolism results in trimethylaminuria (fish odour syndrome). Five mammalian forms of FMO are now known and have been designated FMO1-FMO5 [ (PUBMED:1712018) (PUBMED:2318837) (PUBMED:1542660) (PUBMED:1417778) (PUBMED:8486656) ]. This is a recent nomenclature based on comparison of amino acid sequences, and has been introduced in an attempt to eliminate confusion inherent in multiple, laboratory-specific designations and tissue-based classifications [ (PUBMED:8311461) ]. Following the determination of the complete nucleotide sequence of Saccharomyces cerevisiae (Baker's yeast) [ (PUBMED:8091229) ], a novel gene was found to encode a protein with similarity to mammalian monooygenases. In Aspergillus, flavin-containing monooxygenases ustF1 and ustF2 are components in the biosynthesis of the antimitotic tetrapeptide ustiloxin B, a secondary metabolite. The monooxygenases modify the side chain of the intermediate S-deoxyustiloxin H [ (PUBMED:27166860) ]. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | NADP binding (GO:0050661), N,N-dimethylaniline monooxygenase activity (GO:0004499), flavin adenine dinucleotide binding (GO:0050660) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FMO-like