The domain within your query sequence starts at position 41 and ends at position 159; the E-value for the FNIP_N domain shown below is 1.7e-29.
QIRLIVYQDCERRGRNVLFDSSVKRKNEDTSVSKLCNDAQVKVFGKCCQLKPGGDSSSSL DSSITLSSDGKDQCPKYQGSRCSSDANMLGEMMFGSVAMSYKGSTLKIHQIRSPPQLML
FNIP_N |
![]() |
---|
PFAM accession number: | PF14636 |
---|---|
Interpro abstract (IPR028084): | This domain is found at the N terminus of folliculin-interacting proteins [ (PUBMED:18663353) (PUBMED:18403135) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FNIP_N