The domain within your query sequence starts at position 51 and ends at position 199; the E-value for the FPL domain shown below is 1.1e-60.
IRSITEILIWGDQNDSSVFDFFLEKNMFVFFLNILRQKSGRYVCVQLLQTLNILFENISH ETSLYYLLSNNYVNSIIVHKFDFSDEEIMAYYISFLKTLSLKLNNHTVHFFYNEHTNDFA LYTEAIKFFNHPESMVRIAVRTITLNVYK
FPL |
![]() |
---|
PFAM accession number: | PF09758 |
---|---|
Interpro abstract (IPR019155): | CLEC16A (C-Type Lectin Domain Containing 16A) has an inhibitory role in autophagy, probably by activating the mTOR pathway [ (PUBMED:28223137) ]. It also has a role in beta-cells as a regulator of mitophagy [ (PUBMED:24949970) ]. GFS9/TT9 (TRANSPARENT TESTA 9) is a protein from Arabidopsis required for vacuolar development through membrane fusion at vacuoles. It contributes to intracellular membrane trafficking and flavonoid accumulation [ (PUBMED:25116949) ]. This entry represents a domain found at the N terminus of CLEC16A and GFS9/TT9. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FPL