The domain within your query sequence starts at position 326 and ends at position 495; the E-value for the FTO_CTD domain shown below is 1.1e-69.
GTLDYILERCQLALQNVLNDSDDGDVSLKSFDPAVLKQGEEIHNEVEFEWLRQFWFQGNR YKLCTDWWCEPMTHLEGLWKKMESMTNAVLREVKREGLPVEQRSEILSAILVPLTVRQNL RKEWHARCQSRVVRTLPVQQKPDCRPYWEKDDPSMPLPFDLTDVVSELRG
FTO_CTD |
---|
PFAM accession number: | PF12934 |
---|---|
Interpro abstract (IPR024366): | This domain is found at the C terminus of the FTO protein. The N-terminal domain of this protein is a DNA demethylase, and this domain is found to associate with the N-terminal domain in the crystal structure [ (PUBMED:20376003) ]. This domain is alpha helical with three helices that form a bundle [ (PUBMED:20376003) ]. Alpha-ketoglutarate-dependent dioxygenase FTO, also known as Fat mass and obesity-associated protein, is a nucleus protein which belongs to the FTO family. This enzyme is a dioxygenase that repairs alkylated DNA and RNA by oxidative demethylation [ (PUBMED:17991826) ]. FTO activity is highest towards single-stranded RNA containing 3-methyluracil, followed by single-stranded DNA containing 3-methylthymine. FTO has low demethylase activity towards single-stranded DNA containing 1-methyladenine or 3-methylcytosine [ (PUBMED:18775698) ]. FTO has no activity towards 1-methylguanine. It has no detectable activity towards double-stranded DNA. FTO requires molecular oxygen, alpha-ketoglutarate and iron. FTO contributes to the regulation of the global metabolic rate, energy expenditure and energy homeostasis. It contributes to the regulation of body size and body fat accumulation as well [ (PUBMED:19234441) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FTO_CTD