The domain within your query sequence starts at position 136 and ends at position 293; the E-value for the FWWh domain shown below is 3.8e-54.
IEGCTFLFNQNEVTQLPRHLDAKQIYLYVLKTHNFEEKVFKVWKTHVLSDCSIALLHDSF WWWFLHKFKPDKRDEDFLFDRIAESYVTLFIKIPLRRKDAFFKMYPDCLTQAVYTTFQES FPESCSLFNDKFKEDLGNTIFLWLSGLKPETGFWTHWK
FWWh |
![]() |
---|
PFAM accession number: | PF14922 |
---|---|
Interpro abstract (IPR029417): | This entry represents a group of eukaryotic proteins that carry a highly distinctive, conserved sequence motif of FWWh, where h represents a hydrophobic residue. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FWWh