The domain within your query sequence starts at position 548 and ends at position 630; the E-value for the FXMR_C2 domain shown below is 4.9e-34.
GFKGNDDHSRTDNRPRNPREAKGRTADGSLQITVNCNNEKTVHTKPLQSASSEGSRLRTG KDRNQKKEKPDSVDGLQPLVNGV
FXMR_C2 |
 |
|---|
| PFAM accession number: | PF16098 |
|---|---|
| Interpro abstract (IPR032196): | This is a small highly conserved region at the very C terminus of Fragile X-related proteins FMR1 [ (PUBMED:20463240) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FXMR_C2