The domain within your query sequence starts at position 489 and ends at position 564; the E-value for the FXR_C1 domain shown below is 1.9e-41.
GGKSSISSVLKDPDSNPYSLLDNTESDQTADTDASESHHSTNRRRRSRRRRTDEDAVLMD GLTESDTASVNENGLD
FXR_C1 |
 |
|---|
| PFAM accession number: | PF16096 |
|---|---|
| Interpro abstract (IPR032172): | This is a small highly conserved region of the C terminus of Fragile X-related proteins 1 and 2, FRX1, FRX2. The domain is immediately C-terminal to the core C- terminal region, IPR022034 and contains at least one block of RGG repeats that bind to G-quartet sequences in a wide variety of mRNAs [ (PUBMED:20463240) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FXR_C1