The domain within your query sequence starts at position 12 and ends at position 178; the E-value for the Far-17a_AIG1 domain shown below is 3.4e-59.
AILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSG NQEQERQLRKLISLRDWTLAVLAFPVGVFVVAVFWTIYAYDREMIYPRLLDNFIPGWLNH GMHTTVLPFILIEMRTSHHQYPSRSSGLAAICTFSVGYILWYRRRKR
Far-17a_AIG1 |
---|
PFAM accession number: | PF04750 |
---|---|
Interpro abstract (IPR006838): | This family includes the hamster androgen-induced FAR-17a protein [ (PUBMED:2045681) ], and its human homologue, the AIG1 protein [ (PUBMED:11266118) ]. The function of these proteins is unknown. This family also includes homologous regions from a number of other metazoan proteins. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Far-17a_AIG1