The domain within your query sequence starts at position 53 and ends at position 155; the E-value for the Fe-ADH_2 domain shown below is 6.5e-13.
RYGAGVTKEVGMDLQNMGAKNVCLMTDKNLSQLPPVQIVMDSLSKNGISFQVYDDVRVEP TDGSFMDAIEFAKKGAFDAYVAVGGGSTMDTCKAANLYASSPH
Fe-ADH_2 |
---|
PFAM accession number: | PF13685 |
---|---|
Interpro abstract (IPR032837): | This entry includes glycerol-1-phosphate dehydrogenases (G1PDH) from archaea and bacteria. G1PDH catalyses the NAD(P)H-dependent reduction of dihydroxyacetonephosphate (DHAP or glycerone phosphate) to glycerol 1-phosphate (G1P) [ (PUBMED:18558723) (PUBMED:9348086) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fe-ADH_2