The domain within your query sequence starts at position 90 and ends at position 163; the E-value for the Fer2_2 domain shown below is 4.1e-31.
TVEGIGNTKKLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNKPEPTVEEIENAFQGNL CRCTGYRPILQGFR
Fer2_2 |
---|
PFAM accession number: | PF01799 |
---|---|
Interpro abstract (IPR002888): | The [2Fe-2S] binding domain is found in a range of enzymes including dehydrogenases, oxidases and oxidoreductases. The aldehyde oxido-reductase (Mop) from the sulphate reducing anaerobic Gram-negative bacterium Desulfovibrio gigas is a homodimer of 907 amino acid residues subunits and is a member of the xanthine oxidase family. The protein contains a molybdopterin cofactor (Mo-co) and two different [2Fe-2S] centres. It is folded into four domains of which the first two bind the iron sulphur centres and the last two are involved in Mo-co binding. Mo-co is a molybdenum molybdopterin cytosine dinucleotide. Molybdopterin forms a tricyclic system with the pterin bicycle annealed to a pyran ring. The molybdopterin dinucleotide is deeply buried in the protein. The cis-dithiolene group of the pyran ring binds the molybdenum, which is coordinated by three more (oxygen) ligands [ (PUBMED:7502041) ]. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | oxidoreductase activity (GO:0016491), metal ion binding (GO:0046872) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fer2_2