The domain within your query sequence starts at position 43 and ends at position 150; the E-value for the Fer2_3 domain shown below is 5e-36.
KFAIYRWDPDKTGDKPRMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGS CAMNINGGNTLACTRRIDTDLSKVSKIYPLPHMYVIKDLVPDLSNFYA
Fer2_3 |
 |
|---|
| PFAM accession number: | PF13085 |
|---|---|
| Interpro abstract (IPR025192): | This entry represents the 2Fe-2S iron-sulphur cluster binding domain found in members of the succinate dehydrogenase/fumarate reductase protein family. The domain is around one hundred amino acids with four conserved cysteine residues to which the 2Fe-2S cluster is ligated. |
| GO function: | electron transfer activity (GO:0009055), iron-sulfur cluster binding (GO:0051536) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fer2_3