The domain within your query sequence starts at position 55 and ends at position 168; the E-value for the Fer4_20 domain shown below is 4.6e-35.
LESNFDDIKHTTLGERGALREAVRCLKCADAPCQKSCPTSLDIKSFITSIANKNYYGAAK LIFSDNPLGLTCGMVCPTSDLCVGGCNLHAAEEGPINIGGLQQFATEVFKAMNI
Fer4_20 |
---|
PFAM accession number: | PF14691 |
---|---|
Interpro abstract (IPR028261): | Domain II of the enzyme dihydroprymidine dehydrogenase binds FAD. Dihydroprymidine dehydrogenase catalyses the first and rate-limiting step of pyrimidine degradation by converting pyrimidines to the corresponding 5,6- dihydro compounds [ (PUBMED:11796730) ]. This domain carries two Fe4-S4 clusters. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fer4_20