The domain within your query sequence starts at position 2005 and ends at position 2109; the E-value for the Ferlin_C domain shown below is 4.4e-22.
CVTEEGEKKMLAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTS PYKTMKFILWRRFRCAIILFIILFILLLFLGVFVYAFPNYAAMKL
Ferlin_C |
---|
PFAM accession number: | PF16165 |
---|---|
Interpro abstract (IPR032362): | This domain is found at the C terminus of proteins belonging to the ferlin family, including dysferlin, myoferlin, otoferlin and fer-1-like proteins [ (PUBMED:20667140) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ferlin_C