SMART: Pfam domain Fibin

The domain within your query sequence starts at position 15 and ends at position 210; the E-value for the Fibin domain shown below is 4.1e-107.

LCRGYFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDRRRCSQGEGGQASS
LLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSD
KSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLAHTI
RSHGTRLGRLKSDYLE

Fibin

PFAM accession number:	PF15819
Interpro abstract (IPR026772):	Fin bud initiation factor (Fibin) forms disulfide-linked homodimers. It seems to also exist as monomers [ (PUBMED:21615908) ]. It localises in endoplasmic reticulum and golgi apparatus [ (PUBMED:17196583) (PUBMED:21615908) ]. In zebrafish, Fibin is essential for the initiation of pectoral fin bud formation. It potentially acts downstream of retinoic acid and Wnt signaling and is required for tbx5 expression in the lateral plate mesoderm of presumptive pectoral fin bud regions [ (PUBMED:17196583) ]. In mammals is expressed in cerebellum, skeletal muscle and other embryonic and adult tissues, suggesting a relevant role during embryogenesis and adult life [ (PUBMED:21615908) ].

PFAM accession number:

PF15819

Interpro abstract (IPR026772):

Fin bud initiation factor (Fibin) forms disulfide-linked homodimers. It seems to also exist as monomers [ (PUBMED:21615908) ]. It localises in endoplasmic reticulum and golgi apparatus [ (PUBMED:17196583) (PUBMED:21615908) ]. In zebrafish, Fibin is essential for the initiation of pectoral fin bud formation. It potentially acts downstream of retinoic acid and Wnt signaling and is required for tbx5 expression in the lateral plate mesoderm of presumptive pectoral fin bud regions [ (PUBMED:17196583) ]. In mammals is expressed in cerebellum, skeletal muscle and other embryonic and adult tissues, suggesting a relevant role during embryogenesis and adult life [ (PUBMED:21615908) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fibin