SMART: Pfam domain Filamin

The domain within your query sequence starts at position 2261 and ends at position 2431; the E-value for the Filamin domain shown below is 7.5e-9.

YADPQKTSLILNKDDIRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKTSLQQD
QGKKCQRIPGSPSAAASSADMTFGGLASPKLDVSYEPMIVKEARYIAITMMKVYENYSFE
ELRFASPTPKRPSENMLIRVNNDGTYCANWTPGAIGLYTVHVTIDGIEIDA

Filamin

PFAM accession number:	PF00630
Interpro abstract (IPR017868):	The many different actin cross-linking proteins share a common architecture, consisting of a globular actin-binding domain and an extended rod. Whereas their actin-binding domains consist of two calponin homology domains (see IPR001715 ), their rods fall into three families. The rod domain of the family including the Dictyostelium discoideum (Slime mould) gelation factor (ABP120) and human filamin (ABP280). It is constructed from tandem repeats of a 100-residue motif that is glycine and proline rich [ (PUBMED:9164464) ]. The gelation factor's rod contains 6 copies of the repeat, whereas filamin has a rod constructed from 24 repeats. The resolution of the 3D structure of rod repeats from the gelation factor has shown that they consist of a beta-sandwich, formed by two beta-sheets arranged in an immunoglobulin-like fold [ (PUBMED:9164464) (PUBMED:10467095) ]. The repeat structure is common to the members of the gelation factor/filamin family. This entry represents the entire filamin/ABP280 repeat.

PFAM accession number:

PF00630

Interpro abstract (IPR017868):

The many different actin cross-linking proteins share a common architecture, consisting of a globular actin-binding domain and an extended rod. Whereas their actin-binding domains consist of two calponin homology domains (see IPR001715 ), their rods fall into three families.

The rod domain of the family including the Dictyostelium discoideum (Slime mould) gelation factor (ABP120) and human filamin (ABP280). It is constructed from tandem repeats of a 100-residue motif that is glycine and proline rich [ (PUBMED:9164464) ]. The gelation factor's rod contains 6 copies of the repeat, whereas filamin has a rod constructed from 24 repeats. The resolution of the 3D structure of rod repeats from the gelation factor has shown that they consist of a beta-sandwich, formed by two beta-sheets arranged in an immunoglobulin-like fold [ (PUBMED:9164464) (PUBMED:10467095) ]. The repeat structure is common to the members of the gelation factor/filamin family.

This entry represents the entire filamin/ABP280 repeat.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Filamin