The domain within your query sequence starts at position 64 and ends at position 116; the E-value for the Fis1_TPR_C domain shown below is 6.1e-28.

RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGL

Fis1_TPR_C

Fis1_TPR_C
PFAM accession number:PF14853
Interpro abstract (IPR028061):

The mitochondrial fission protein Fis1 consists of two tetratricopeptide repeats. This entry represents the C-terminal tetratricopeptide repeat [ (PUBMED:14623186) (PUBMED:14705031) ]. Fis1 is an outer mitochondrial membrane protein that plays a role in mitochondrial membrane fission [ (PUBMED:11038183) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fis1_TPR_C