The domain within your query sequence starts at position 18 and ends at position 149; the E-value for the Flavoprotein domain shown below is 7.9e-51.
FRVLVGVTGSVAALKLPLLVSKLLDVPGLEVTVVTTERAKHFYSPQDVPVTLYSDADEWE MWKRRSDPVLHIDLRRWADLMLVAPLDANTLGKVASGICDNLLTCVIRAWDLNKPLLFCP AMNTAMWEHPLT
Flavoprotein |
---|
PFAM accession number: | PF02441 |
---|---|
Interpro abstract (IPR003382): | This entry contains a diverse range of flavoprotein enzymes, including epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN [ (PUBMED:1644762) ]. This enzyme catalyzes the removal of two reducing equivalents from the cysteine residue of the C-terminal meso-lanthionine of epidermin to form a --C==C-- double bond. This family also includes the B chain of dipicolinate synthase a small polar molecule that accumulates to high concentrations in bacterial endospores, and is thought to play a role in spore heat resistance, or the maintenance of heat resistance [ (PUBMED:8345520) ]. Dipicolinate synthase catalyses the formation of dipicolinic acid from dihydroxydipicolinic acid. This family also includes phenylacrylic acid decarboxylase EC 4.1.1 [ (PUBMED:8181743) ]. |
GO function: | catalytic activity (GO:0003824) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Flavoprotein