The domain within your query sequence starts at position 311 and ends at position 422; the E-value for the Flot domain shown below is 5.1e-12.
LAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAK ISAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKN
Flot |
![]() |
---|
PFAM accession number: | PF15975 |
---|---|
Interpro abstract (IPR031905): | Flotillin is a family of lipid-membrane-associated proteins found in bacteria, archaea and eukaryotes. Flotillins in vertebrates are associated with sphingolipids and cholesterol-enriched membrane microdomains, known as lipid-rafts [ (PUBMED:22329548) ]. These rafts, along with other membrane components, are important in cell-signalling. Flotillins in other organisms have roles in viral pathogenesis, endocytosis, and membrane shaping [ (PUBMED:20018678) (PUBMED:22215737) (PUBMED:22882210) ]. This entry represents the C-terminal domain of flotilin-1 and flotilin-2. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Flot