The domain within your query sequence starts at position 914 and ends at position 1046; the E-value for the Focal_AT domain shown below is 5e-59.
TANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIP ALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKN LLDVIDQARLKML
Focal_AT |
![]() |
---|
PFAM accession number: | PF03623 |
---|---|
Interpro abstract (IPR005189): | Focal adhesion kinase (FAK) is a tyrosine kinase found in focal adhesions, intracellular signalling complexes that are formed following engagement of the extracellular matrix by integrins. The C-terminal "focal adhesion targeting" (FAT) region is necessary and sufficient for localizing FAK to focal adhesions. The crystal structure of FAT shows it forms a four-helix bundle that resembles those found in two other proteins involved in cell adhesion, alpha-catenin and vinculin [ (PUBMED:11799401) ]. The binding of FAT to the focal adhesion protein, paxillin, requires the integrity of the helical bundle, whereas binding to another focal adhesion protein, talin, does not. |
GO process: | signal complex assembly (GO:0007172), protein phosphorylation (GO:0006468) |
GO component: | focal adhesion (GO:0005925) |
GO function: | protein tyrosine kinase activity (GO:0004713) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Focal_AT