The domain within your query sequence starts at position 204 and ends at position 310; the E-value for the Formyl_trans_C domain shown below is 1.5e-17.
QKKETAMINWDQPAEAIHNWIRGNDKVPGAWTEACGQKLTFFNSTLNTSGLVAQGEALPI PGAHRPGLVTKAGLILFGNDDRMLLVKNIQLEDGKMMPASQFFKGSA
Formyl_trans_C |
![]() |
---|
PFAM accession number: | PF02911 |
---|---|
Interpro abstract (IPR005793): | Methionyl-tRNA formyltransferase ( EC 2.1.2.9 ) transfers a formyl group onto the amino terminus of the acyl moiety of the methionyl aminoacyl-tRNA. The formyl group appears to play a dual role in the initiator identity of N-formylmethionyl-tRNA by promoting its recognition by IF2 and by impairing its binding to EFTU-GTP. This family also includes formyltetrahydrofolate dehydrogenases, which produce formate from formyl-tetrahydrofolate. These enzymes contain an N-terminal domain in common with other formyl transferase enzymes ( IPR002376 ). The C-terminal domain has an open beta-barrel fold [ (PUBMED:8887566) ]. |
GO process: | biosynthetic process (GO:0009058) |
GO function: | hydroxymethyl-, formyl- and related transferase activity (GO:0016742) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Formyl_trans_C