The domain within your query sequence starts at position 4 and ends at position 135; the E-value for the Formyl_trans_N domain shown below is 4.2e-42.

AVIGQSLFGQEAEKDGVPVFKFPRWRARGQALPEVVAKYQALGAELNVLPFCSQFIPMEV
INAPRHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFTIFWADDGLDTGDLLLQKECDV
LPDDTVSTLYNR

Formyl_trans_N

 Formyl_trans_N
PFAM accession number:PF00551
Interpro abstract (IPR002376):

A number of formyl transferases belong to this group. Methionyl-tRNA formyltransferase transfers a formyl group onto the amino terminus of the acyl moiety of the methionyl minoacyl-tRNA. The formyl group appears to play a dual role in the initiator identity of N-ormylmethionyl-tRNA by promoting its recognition by IF2 and by impairing its binding to EFTU-GTP. Formyltetrahydrofolate dehydrogenase produces formate from formyl-tetrahydrofolate. This is the N-terminal domain of these enzymes and is found upstream of the C-terminal domain ( IPR005793 ).

The trifunctional glycinamide ribonucleotide synthetase-aminoimidazole ribonucleotide synthetase-glycinamide ribonucleotide transformylase catalyses the second, third and fifth steps in de novo purine biosynthesis. The glycinamide ribonucleotide transformylase belongs to this group.

GO process:biosynthetic process (GO:0009058)
GO function:hydroxymethyl-, formyl- and related transferase activity (GO:0016742)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Formyl_trans_N