The domain within your query sequence starts at position 34 and ends at position 218; the E-value for the G6PD_N domain shown below is 1.6e-41.
ILLGATGDLAKKYLWQGLFQLYLDEAGKGHSFSFHGAALTAPQQGQKLMDKVLESLSCPK DLVPSRCDELKGQFLQLSQYRQLKTVEDYQTLNKDIETQVQQDGLWEAGRIFYFSVPPFA YADIARNINSSCRPHPGAWLRVVFEKPFGHDHLSAQQLASELGSFFQEEEMYRVDHYLGK QAVAQ
G6PD_N |
---|
PFAM accession number: | PF00479 |
---|---|
Interpro abstract (IPR022674): | Glucose-6-phosphate dehydrogenase ( EC 1.1.1.49 ) (G6PDH) is a ubiquitous protein, present in bacteria and all eukaryotic cell types [ (PUBMED:2838391) ]. The enzyme catalyses the the first step in the pentose pathway, i.e. the conversion of glucose-6-phosphate to gluconolactone 6-phosphate in the presence of NADP, producing NADPH. The ubiquitous expression of the enzyme gives it a major role in the production of NADPH for the many NADPH-mediated reductive processes in all cells [ (PUBMED:3393536) ]. Deficiency of G6PDH is a common genetic abnormality affecting millions of people worldwide. Many sequence variants, most caused by single point mutations, are known, exhibiting a wide variety of phenotypes [ (PUBMED:3393536) ]. This entry represents the NAD-binding domain of glucose-6-phosphate dehydrogenase. |
GO process: | glucose metabolic process (GO:0006006), oxidation-reduction process (GO:0055114) |
GO function: | oxidoreductase activity, acting on CH-OH group of donors (GO:0016614), NADP binding (GO:0050661) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry G6PD_N