The domain within your query sequence starts at position 3 and ends at position 104; the E-value for the GARS_N domain shown below is 1.4e-40.

ARVLVIGSGGREHTLAWKLAQSPQVKQVLVAPGNAGTACAGKISNAAVSVNDHSALAQFC
KDEKIELVVVGPEAPLAAGIVGDLTSAGVRCFGPTAQAAQLE

GARS_N

• PFAM accession number: PF02844
• Interpro abstract (IPR020562):

  Phosphoribosylglycinamide synthetase ( EC 6.3.4.13 ) (GARS) (phosphoribosylamine glycine ligase) [ (PUBMED:2687276) ] catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by phosphoribosylglycinamide synthetase is the ATP-dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide: ATP + 5-phosphoribosylamine + glycine = ADP + P _i + 5'-phosphoribosylglycinamide In bacteria, GARS is a monofunctional enzyme (encoded by the purD gene). In yeast, GARS is part of a bifunctional enzyme (encoded by the ADE5,7 gene) in conjunction with phosphoribosylformylglycinamidine cyclo-ligase (AIRS) [ (PUBMED:3097325) ]. In higher eukaryotes, GARS is part of a trifunctional enzyme in conjunction with AIRS and with phosphoribosylglycinamide formyltransferase (GART), forming GARS-AIRS-GART [ (PUBMED:2147474) ].

  This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase ( IPR005481 ).

• GO process: purine nucleobase biosynthetic process (GO:0009113)
• GO function: phosphoribosylamine-glycine ligase activity (GO:0004637)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GARS_N