The domain within your query sequence starts at position 3 and ends at position 104; the E-value for the GARS_N domain shown below is 6.4e-37.
ARVLVIGSGGREHTLAWKLAQSPQVKQVLVAPGNAGTACAGKISNAAVSVNDHSALAQFC KDEKIELVVVGPEAPLAAGIVGDLTSAGVRCFGPTAQAAQLE
GARS_N |
![]() |
---|
PFAM accession number: | PF02844 |
---|---|
Interpro abstract (IPR020562): | Phosphoribosylglycinamide synthetase ( EC 6.3.4.13 ) (GARS) (phosphoribosylamine glycine ligase) [ (PUBMED:2687276) ] catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by phosphoribosylglycinamide synthetase is the ATP-dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide: This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase ( IPR005481 ). |
GO process: | purine nucleobase biosynthetic process (GO:0009113) |
GO function: | phosphoribosylamine-glycine ligase activity (GO:0004637) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GARS_N