The domain within your query sequence starts at position 215 and ends at position 284; the E-value for the GAS2 domain shown below is 1.8e-29.
LHEAVKHIAEDPPCSCSHRFSIEYLSEGRYRLGEKILFIRMLHGKHVMVRVGGGWDTLQG FLLKYDPCRI
GAS2 |
![]() |
---|
PFAM accession number: | PF02187 |
---|---|
Interpro abstract (IPR003108): | The GAR (Gas2-related) domain is common in plakin family members and Gas2 family members. It comprises around 57 amino acids and has been shown to bind to microtubules [ (PUBMED:20335501) (PUBMED:11112700) (PUBMED:11854008) ]. |
GO function: | microtubule binding (GO:0008017) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GAS2