The domain within your query sequence starts at position 147 and ends at position 372; the E-value for the GATA-N domain shown below is 2.3e-62.

MYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTRVGSMLSGLPYLQG
AGSGPSNHAGGAGAHPGWSQASADSPPYGGGGAAGGGAAGPGGAGSATAHASARFPYSPS
PPMANGAARDPGGYVAAGGTGAGSVSGGGGSLAAMGGREHQYSSLSAARPLNGTYHHHHH
HHPTYSPYMAAPLTPAWPAGPFETPVLHSLQGRAGAPLPVPRGPST

GATA-N

 GATA-N
PFAM accession number:PF05349
Interpro abstract (IPR008013):

GATA transcription factors mediate cell differentiation in a diverse range of tissues. Mutations are often associated with certain congenital human disorders. The six classical vertebrate GATA proteins, GATA-1 to GATA-6, are highly homologous and have two tandem zinc fingers. The classical GATA transcription factors function as transcription activators. In lower metazoans GATA proteins carry a single canonical zinc finger. This entry represents the N-terminal domain of the family of GATA transcription activators.

GO process:positive regulation of transcription, DNA-templated (GO:0045893)
GO component:nucleus (GO:0005634)
GO function:DNA binding (GO:0003677), zinc ion binding (GO:0008270)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GATA-N