The domain within your query sequence starts at position 4 and ends at position 121; the E-value for the GCN5L1 domain shown below is 1.7e-51.
YSDHPELREPRWREKRRREAIAAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQA AQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS
GCN5L1 |
 |
|---|
| PFAM accession number: | PF06320 |
|---|---|
| Interpro abstract (IPR009395): | GCN5L1 (general control of amino acid synthesis 5-like 1), also known as BLOC1S1 (biogenesis of lysosome-related organelles complex 1 subunit 1). It is a component of the BLOC-1 complex, a complex required for normal biogenesis of lysosome-related organelles [ (PUBMED:17182842) ]. GCN5L1 has been identified as a critical component of the mitochondrial protein acetylation programme [ (PUBMED:22309213) (PUBMED:25400169) ]. It acts as a nutrient-sensing regulator that controls mitochondrial content through coordinated regulation of mitochondrial biogenesis and autophagy [ (PUBMED:24356961) ]. |
| GO component: | BLOC-1 complex (GO:0031083) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GCN5L1