The domain within your query sequence starts at position 1 and ends at position 207; the E-value for the GEMIN8 domain shown below is 7.7e-76.
MGHQNAYRKFRDSYFTSPWLFPHGALPWNSPAYEAGHPWDSQGQHMAQQESPYRVSHPKS PGQPLRNSSRTQASTRGNEARCEEEELESDSDDEVECDLSNMEITEELRQYFAQTERHRE ERRRQQQLDAERLNDYVNADHGLYFNHRRSLEPPSEKPWERRQAEMKRLYGNSAPKILAM ETAVQLSFDKHCDRKQPKYWPVIPLKF
GEMIN8 |
---|
PFAM accession number: | PF15348 |
---|---|
Interpro abstract (IPR034754): | GEMIN8 proteins are found in the nuclear bodies called gems (Gemini of Cajal bodies) that are often in proximity to Cajal (coiled) bodies themselves. They are also found in the cytoplasm [ (PUBMED:16434402) ]. The family is part of the SMN (survival motor neurone) complex that plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. GEMIN8 binds directly to SMN1 and mediates the interaction of the GEMIN6-GEMIN7 heterodimer [ (PUBMED:17023415) ]. |
GO process: | spliceosomal snRNP assembly (GO:0000387) |
GO component: | SMN complex (GO:0032797) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GEMIN8