The domain within your query sequence starts at position 9 and ends at position 123; the E-value for the GFO_IDH_MocA domain shown below is 1e-22.
FGVVVVGVGRAGSVRIRDLKDPHSSAFLNLIGYVSRRELGSLDNVRQISLEDALRSQEVD VAYICTESSSHEDYIRQFLQAGKHVLVEYPMALSFAAAQELWELAAQKDYHHTCC
GFO_IDH_MocA |
![]() |
---|
PFAM accession number: | PF01408 |
---|---|
Interpro abstract (IPR000683): | This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot. GFO is a glucose--fructose oxidoreductase, which converts D-glucose and D-fructose into D-gluconolactone and D-glucitol in the sorbitol-gluconate pathway. MOCA is a rhizopine catabolism protein which may catalyse the NADH-dependent dehydrogenase reaction involved in rhizopine catabolism. Other proteins belonging to this family include Gal80, a negative regulator for the expression of lactose and galactose metabolic genes; and several hypothetical proteins from yeast, Escherichia coli and Bacillus subtilis. The oxidoreductase, N-terminal domain is almost always associated with the oxidoreductase, C-terminal domain (see IPR004104 ). |
GO function: | oxidoreductase activity (GO:0016491) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GFO_IDH_MocA