The domain within your query sequence starts at position 38 and ends at position 342; the E-value for the GGN domain shown below is 2.1e-158.
GNVQSEPSAGGGSRKEQASDRASDSRRTPLVEPEVTPSSPAMRLARGLGVWFPGSSGPPG LLIPPEPQASSSPLPLTLELPSPVTPPPEEAAAVSTPPPPPVGTLLPAPSKWRKPTGTSV PRIRGLLEASHRGQGDPPSLRPLPPLPRQLTEKDPVLRAPAPPPTPLEPRKQLPPAPSTC DPQPLSRRITLASSATSPTESQVRHSSEGQAAGGAHGGVPPQAGEGEMARSATSESGLSL LCKVTFKSGPHLSPTSASGPLAAKASPGAGGGGLFASSGAISYAEVLKQGPQPPGATRPL GEVPP
GGN |
---|
PFAM accession number: | PF15685 |
---|---|
Interpro abstract (IPR031400): | Gametogenetin (GGN) is a family of proteins largely found in vertebrates. GGN reacts with POG in the maturation of sperm [ (PUBMED:12574169) ] and is expressed virtually only in the testis. It is also expressed in lower levels in the oocyte and is required for the survival of pre-implantation embryos [ (PUBMED:23451117) ]. GGN plays a role in male meiotic DNA double strand break repair [ (PUBMED:23451117) ]. It is found to be associated with the intracellular membrane, binds with GGNBP1 and may be involved in vesicular trafficking [ (PUBMED:15642376) ]. |
GO process: | gamete generation (GO:0007276), double-strand break repair (GO:0006302) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GGN