SMART: Pfam domain GHMP_kinases

The domain within your query sequence starts at position 970 and ends at position 1052; the E-value for the GHMP_kinases_C domain shown below is 1e-8.

CAEAFRQGNLPLLGQYLTSYWEQKKLMAPGCEPLAVQRMMDVLAPYAYGQSLAGAGGGGF
LYLLTKEPRQKETLEAVLAKAEG

GHMP_kinases_C

PFAM accession number:	PF08544
Interpro abstract (IPR013750):	This domain is found in homoserine kinases ( EC 2.7.1.39 ), galactokinases ( EC 2.7.1.6 ) and mevalonate kinases ( EC 2.7.1.36 ). These kinases make up the GHMP kinase superfamily of ATP-dependent enzymes [ (PUBMED:8382990) ]. These enzymes are involved in the biosynthesis of isoprenes and amino acids as well as in carbohydrate metabolism. The C-terminal domain of homoserine kinase has a central alpha-beta plait fold and an insertion of four helices, which, together with the N-terminal fold, create a novel nucleotide binding fold [ (PUBMED:11188689) ]. This domain is also found in some diphosphomevalonate decarboxylases, which are structurally related members of the GHMP superfamily [ (PUBMED:17583736) ], but do not possess kinase activity.

PFAM accession number:

PF08544

Interpro abstract (IPR013750):

This domain is found in homoserine kinases ( EC 2.7.1.39 ), galactokinases ( EC 2.7.1.6 ) and mevalonate kinases ( EC 2.7.1.36 ). These kinases make up the GHMP kinase superfamily of ATP-dependent enzymes [ (PUBMED:8382990) ]. These enzymes are involved in the biosynthesis of isoprenes and amino acids as well as in carbohydrate metabolism. The C-terminal domain of homoserine kinase has a central alpha-beta plait fold and an insertion of four helices, which, together with the N-terminal fold, create a novel nucleotide binding fold [ (PUBMED:11188689) ].

This domain is also found in some diphosphomevalonate decarboxylases, which are structurally related members of the GHMP superfamily [ (PUBMED:17583736) ], but do not possess kinase activity.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GHMP_kinases_C