The domain within your query sequence starts at position 78 and ends at position 303; the E-value for the GKAP domain shown below is 3.9e-28.
EKHLDSQTRETSEMGPLGVFREVESLPATAPAQGKERKSFAPKHCVFQPPCGLKSYQVAP LSPRSANAFLTPNCDWNQLRPEVFSTTTQDKANEILVQQGLESLTDRSKDSNHASVKGVP CSEASEGQTSQPPHDVPYFRKILQSETDRLTSHCQEWEGKLDLDIPDEAKGLIRTTVGQT RLLIKERFRQFEGLVDNCEYKRGEKETTCTDLDGFWDMVSFQVDDV
GKAP |
![]() |
---|
PFAM accession number: | PF03359 |
---|---|
Interpro abstract (IPR005026): | This entry represents the SAPAP family, whose members include mars from fruit flies and disks large-associated proteins from vertebrates. Mars binds to microtubules and protein phosphatase 1. It is involved in cell signalling, mitotic spindle organisation and regulation of mitotic cell cycle [ (PUBMED:23593258) (PUBMED:17007873) ]. It is essential for the early development of Drosophila embryos [ (PUBMED:23593258) ]. Disks large-associated proteins are synaptic proteins that may play several roles in the molecular organisation of synapses and neuronal cell signalling [ (PUBMED:9024696) (PUBMED:9286858) ]. |
GO process: | signaling (GO:0023052) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GKAP