The domain within your query sequence starts at position 431 and ends at position 569; the E-value for the GMC_oxred_C domain shown below is 5.9e-42.

ATSVGWLKLRSANPRDHPVIHPNYLSTETDVEDFRQCVRLSREIFAQEALAPFRGKELQP
GSHVQSDKEIDAFVRAKADSAYHPSCTCKMGRSSDPTAVVDAQTKVIGVENLRVVDASIM
PSVVSGNLNAPTVMIAEKA

GMC_oxred_C

• PFAM accession number: PF05199
• Interpro abstract (IPR007867):

  The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [ (PUBMED:1542121) (PUBMED:8218217) ]. These enzymes include a variety of proteins; choline dehydrogenase (CHD), methanol oxidase (MOX) and cellobiose dehydrogenase ( EC 1.1.99.18 ) [ (PUBMED:10725534) ] which share a number of regions of sequence similarities. The function of this C-terminal conserved domain is not yet known.

• GO process: oxidation-reduction process (GO:0055114)
• GO function: oxidoreductase activity, acting on CH-OH group of donors (GO:0016614)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GMC_oxred_C