The domain within your query sequence starts at position 1 and ends at position 121; the E-value for the GREB1 domain shown below is 4.5e-61.
XVTYQQTVFHVWHSGVLLELGLEKEPVTKQRAEQHVLKLDTEAQARFKAFLQNSFQNPHT LFVLIHDHAHWDLVSAVHNIYSQSDPSVGLVDRLLNCREVKEAPNIVTLHVTSFPYALQT Q
GREB1 |
![]() |
---|
PFAM accession number: | PF15782 |
---|---|
Interpro abstract (IPR028422): | GREB1 (gene regulated in breast cancer 1 protein) may play a role in estrogen-stimulated cell proliferation. It acts as a regulator of hormone-dependent cancer growth in breast and prostate cancers [ (PUBMED:15986123) (PUBMED:16496412) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GREB1