The domain within your query sequence starts at position 1 and ends at position 122; the E-value for the GREB1 domain shown below is 1.8e-41.

XFRLLIEGKLSKTNYVVIICACRNAAIDSCIAVTGKYQARILSESLLSPAEYQREVHYEL
VTGKVDSLGTFFSSLCPEGDIDILLDKFHQENQGHVSSSFTASSTKKTAVLDASGVPVCT
SE

GREB1

• PFAM accession number: PF15782
• Interpro abstract (IPR028422):

  GREB1 (gene regulated in breast cancer 1 protein) may play a role in estrogen-stimulated cell proliferation. It acts as a regulator of hormone-dependent cancer growth in breast and prostate cancers [ (PUBMED:15986123) (PUBMED:16496412) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GREB1