The domain within your query sequence starts at position 72 and ends at position 212; the E-value for the GSH-S_ATP domain shown below is 1.3e-14.
LPDTFSYGGHENFAKMIDEAEVLEFPMVVKNTRGHRGKAVFLARDKHHLADLSHLIRHEA PYLFQKYIKESHGRDVRVIVVGGRVVGTMLRCSTDGRMQSNCSLGGVGMMCSLSEQGKQL AIQVSNILGTDVCGIDLLMKD
GSH-S_ATP |
 |
|---|
| PFAM accession number: | PF02955 |
|---|---|
| Interpro abstract (IPR004218): | Prokaryotic glutathione synthetase EC 6.3.2.3 (glutathione synthase) catalyses the conversion of gamma-L-glutamyl-L-cysteine and glycine to orthophosphate and glutathione in the presence of ATP. This is the second step in glutathione biosynthesis. The enzyme is inhibited by 7,8-dihydrofolate, methotrexate and trimethoprim. This is the ATP-binding domain of the enzyme. |
| GO process: | glutathione biosynthetic process (GO:0006750) |
| GO function: | glutathione synthase activity (GO:0004363), ATP binding (GO:0005524) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GSH-S_ATP