SMART: Pfam domain GSK-3

The domain within your query sequence starts at position 1 and ends at position 140; the E-value for the GSK-3_bind domain shown below is 2.3e-75.

MPCRREEEEEAGDEAEGEEDDDSFLLLQQSVTLGGSTDVDRLIVQIGETLQLDTAHDRPA
SPCAAPGPPPAPPRVLAALSADKTGTPARRLLRPTGSAETGDPAPPGAVRCVLGERGRVR
GRSAPYCVAEIAPGASALPG

GSK-3_bind

PFAM accession number:	PF05350
Interpro abstract (IPR008014):	Glycogen synthase kinase-3 (GSK-3) sequentially phosphorylates four serine residues on glycogen synthase (GS), in the sequence SxxxSxxxSxxx-SxxxS(p), by recognising and phosphorylating the first serine in the sequence motif SxxxS(P) (where S(p) represents a phosphoserine). Interaction of GSK-3 with a peptide derived from GSK-3 binding protein prevents GSK-3 interaction with Axin. This interaction thereby inhibits the Axin-dependent phosphorylation of beta-catenin by GSK-3 [ (PUBMED:11738041) ].

PFAM accession number:

PF05350

Interpro abstract (IPR008014):

Glycogen synthase kinase-3 (GSK-3) sequentially phosphorylates four serine residues on glycogen synthase (GS), in the sequence SxxxSxxxSxxx-SxxxS(p), by recognising and phosphorylating the first serine in the sequence motif SxxxS(P) (where S(p) represents a phosphoserine). Interaction of GSK-3 with a peptide derived from GSK-3 binding protein prevents GSK-3 interaction with Axin. This interaction thereby inhibits the Axin-dependent phosphorylation of beta-catenin by GSK-3 [ (PUBMED:11738041) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GSK-3_bind