The domain within your query sequence starts at position 351 and ends at position 426; the E-value for the GTF2I domain shown below is 3.8e-33.
LRECVQILFNSRYAEALGLDHMVPVPYRKIACDPEAVEIVGIPDKIPFKRPCTYGVPKLK RILEERHSIHFIIKRM
GTF2I |
---|
PFAM accession number: | PF02946 |
---|---|
Interpro abstract (IPR004212): | This region of sequence similarity is found up to six times in a variety of proteins including general transcription factor II-I (GTF2I). It has been suggested that this may be a DNA binding domain [ (PUBMED:9774679) (PUBMED:10198167) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GTF2I