The domain within your query sequence starts at position 381 and ends at position 448; the E-value for the GTP_EFTU_D2 domain shown below is 3.2e-8.
GPLVFLRIYSGTLTPQLAVHNINRNCTERMSRLLLPFADQHVEIPSLTAGNIALTVGLKQ TATGDTIV
GTP_EFTU_D2 |
---|
PFAM accession number: | PF03144 |
---|---|
Interpro abstract (IPR004161): | Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [ (PUBMED:12762045) (PUBMED:15922593) (PUBMED:12932732) ]. EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution. EF1A (also known as EF-1alpha or EF-Tu) is a G-protein. It forms a ternary complex of EF1A-GTP-aminoacyltRNA. The binding of aminoacyl-tRNA stimulates GTP hydrolysis by EF1A, causing a conformational change in EF1A that causes EF1A-GDP to detach from the ribosome, leaving the aminoacyl-tRNA attached at the A-site. Only the cognate aminoacyl-tRNA can induce the required conformational change in EF1A through its tight anticodon-codon binding [ (PUBMED:15680978) (PUBMED:12102560) ]. EF1A-GDP is returned to its active state, EF1A-GTP, through the action of another elongation factor, EF1B (also known as EF-Ts or EF-1beta/gamma/delta). EF1A consists of three structural domains. This entry represents domain 2 of EF2, which adopts a beta-barrel structure, and is involved in binding to both charged tRNA [ (PUBMED:7491491) ]. This domain is structurally related to the C-terminal domain of EF2 ( IPR004160 ), to which it displays weak sequence matches. This domain is also found in other proteins such as translation initiation factor IF-2 and tetracycline-resistance proteins. |
GO function: | GTP binding (GO:0005525) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GTP_EFTU_D2