The domain within your query sequence starts at position 568 and ends at position 662; the E-value for the GUCT domain shown below is 3.7e-31.
GASSFEPRSLITSDKGFVTMTLESPEEIQDVSCAWKELNRKLSSNAVSHVTRMCLLKGNM GVCFDVPTSESERLQAEWHDSDWILSVPAKLPEIE
GUCT |
![]() |
---|
PFAM accession number: | PF08152 |
---|---|
Interpro abstract (IPR012562): | This is the C-terminal domain found in the RNA helicase II / Gu protein family [ (PUBMED:15112237) ]. |
GO function: | helicase activity (GO:0004386), ATP binding (GO:0005524), RNA binding (GO:0003723) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GUCT