The domain within your query sequence starts at position 692 and ends at position 787; the E-value for the GUCT domain shown below is 1.6e-33.
GATSVDQRSLINSQAGFVTMILRCSIEMPNISYAWKELKEQLGESIDAKVKGMVFLKGKL GVCFDVRTEAVTEIQEKWHDSRRWQLTVATEQPELE
GUCT |
![]() |
---|
PFAM accession number: | PF08152 |
---|---|
Interpro abstract (IPR012562): | This is the C-terminal domain found in the RNA helicase II / Gu protein family [ (PUBMED:15112237) ]. |
GO function: | RNA binding (GO:0003723), ATP binding (GO:0005524), helicase activity (GO:0004386) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GUCT