The domain within your query sequence starts at position 300 and ends at position 462; the E-value for the GWT1 domain shown below is 1.6e-36.
ANREGIISTLGYVTIHMAGVQTGLYVLKGRAQVRDWIKATCWVFSVAVGFFISLHIVQVN IEAVSRRMANLAFCLWVVASSLMLLSCLLLSGIILSFAQFLIKGSLVPCSWKLIQSPTTH KNHSESLILEAEKNQPSLCLITALNRNQLFFFLLSNITTGLIN
GWT1 |
---|
PFAM accession number: | PF06423 |
---|---|
Interpro abstract (IPR009447): | Glycosylphosphatidylinositol (GPI) is a conserved post-translational modification to anchor cell surface proteins to plasma membrane in eukaryotes. PIGW and the yeast homologue GWT1 are involved in the addition of the acyl-chain to inositol in an early step of GPI biosynthesis [ (PUBMED:12714589) ]. Mutations in PIGW are associated with West syndrome and hyperphosphatasia with mental retardation syndrome [ (PUBMED:24367057) ]. |
GO process: | GPI anchor biosynthetic process (GO:0006506) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | transferase activity, transferring acyl groups (GO:0016746) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GWT1