The domain within your query sequence starts at position 3 and ends at position 177; the E-value for the GalP_UDP_transf domain shown below is 3.1e-69.

ATFRASEHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPQLLKTVPRHDPLNPLCPGATRA
NGEVNPHYDGTFLFDNDFPALQPDAPDPGPSDHPLFRAEAARGVCKVMCFHPWSDVTLPL
MSVPEIRAVIDAWASVTEELGAQYPWVQIFENKGAMMGCSNPHPHCQVWASSFLP

GalP_UDP_transf

GalP_UDP_transf
PFAM accession number:PF01087
Interpro abstract (IPR005849):

Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism. The enzyme is present in prokaryotes and eukaryotes. Defects in GalT in humans is the cause of galactosemia, an inherited disorder of galactose metabolism that leads to jaundice, cataracts and mental retardation.

This domain describes the C-terminal of Galactose-1-phosphate uridyl transferase. SCOP reports fold duplication of the C-terminal with the N-terminal domain. Both are involved in Zn and Fe binding

GO process:galactose metabolic process (GO:0006012)
GO function:UDP-glucose:hexose-1-phosphate uridylyltransferase activity (GO:0008108)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GalP_UDP_transf