The domain within your query sequence starts at position 132 and ends at position 331; the E-value for the Galactosyl_T domain shown below is 1e-40.

ERREAVRQTWGAEGRVQGALVRRVFLLGVPKGAGSGGAGTRSHWRTLLEAESRAYADILL
WAFEDTFFNLTLKEIHFLSWASAFCPDVHFVFKGDADVFVHVRNLLQFLELRDPAQDLLA
GDVIVQARPIRARASKYFIPRAVYGLPVYPAYAGGGGFVLSGATLRRLADACSQVELFPI
DDVFLGMCLQRLRLTPEPHP

Galactosyl_T

Galactosyl_T
PFAM accession number:PF01762
Interpro abstract (IPR002659):

The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates ([intenz:2.4.1.-]) and related proteins into distinct sequence based families has been described [ (PUBMED:9334165) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form 'clans'.

Glycosyltransferase family 31 comprises enzymes with a number of known activities; N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase ( EC 2.4.1.149 ); beta-1,3-galactosyltransferase ( EC 2.4.1 ); fucose-specific beta-1,3-N-acetylglucosaminyltransferase ( EC 2.4.1 ); globotriosylceramide beta-1,3-GalNAc transferase ( EC 2.4.1.79 ) [ (PUBMED:9417100) (PUBMED:9417047) ].

GO process:protein glycosylation (GO:0006486)
GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Galactosyl_T