The domain within your query sequence starts at position 65 and ends at position 353; the E-value for the GatB_N domain shown below is 8.3e-101.
AVVGLEIHAQISSNSKLFSGAQVCFAAPPNSLVSYFDASLPGTLPVLNRRCVEAAVMTGL ALNCHINKKSLFDRKHYFYSDLPAGYQITQQRLPIAANGHLTYCIYLGKKPSQVTTKTVR IKQIQLEQDSGKSLHDDLRSQTLIDLNRAGIGLLEVVLEPDLCCGEEAALAVRELQLILQ ALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKNLNSLRFLAKAIDYEIQRQITELE NGGEILNETRSFDYKLGCTMPMRDKEGKQDYRFMPEPNLPPLVLYDDTS
GatB_N |
![]() |
---|
PFAM accession number: | PF02934 |
---|---|
Interpro abstract (IPR006075): | Glutamyl-tRNA(Gln) amidotransferase subunit B ( EC 6.3.5 ) [ (PUBMED:9342321) ] is a microbial enzyme that furnishes a means for formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln). The enzyme is composed of three subunits: A (an amidase), B and C. It also exists in eukaryotes as a protein targeted to the mitochondria. |
GO function: | ligase activity (GO:0016874) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GatB_N