The domain within your query sequence starts at position 1 and ends at position 166; the E-value for the Gemin6 domain shown below is 9.7e-102.

MSEWMKKSPLEWEDYVYKEVRVIACEKEYKGWLLTTDPVSANIVLVNFLEDGRLSVTGIM
GHSVQTVETISEGDHRVREKLMHVFASGDCKGYSPEDLEEKRTSLKKWLEKNHIPVTEQG
DAQRTLCVAGVLTIDPPYAPENCSSSNEIILSRIQDLIQGHLSASQ

Gemin6

 Gemin6
PFAM accession number:PF06372
Interpro abstract (IPR009422):

This family consists of several mammalian Gemin6 proteins. The exact function of Gemin6 is unknown but it has been found to form part of the Survival of motor neuron complex. The SMN complex plays a key role in the biogenesis of spliceosomal small nuclear ribonucleoproteins (snRNPs) and other ribonucleoprotein particles [ (PUBMED:11748230) ].

GO process:spliceosomal complex assembly (GO:0000245)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gemin6