The domain within your query sequence starts at position 418 and ends at position 516; the E-value for the GidB domain shown below is 1.5e-8.
STDRALRKQQQLNNLVYLVLNQAKPGDRIVDFCSGGGHVGIVLAHMLPSCQVTLIENKEL SLIRAKKRSDELGLSNIWFIQANMEYFTGMFNIGVALHA
GidB |
![]() |
---|
PFAM accession number: | PF02527 |
---|---|
Interpro abstract (IPR003682): | This entry represents a rRNA small subunit methyltransferase G. Previously identified as a glucose-inhibited division protein B that appears to be present and in a single copy in all complete eubacterial genomes so far sequenced. Specifically methylates the N7 position of a guanosine in 16S rRNA [ (PUBMED:12001236) (PUBMED:17238915) (PUBMED:17573471) ]. |
GO process: | rRNA processing (GO:0006364) |
GO component: | cytoplasm (GO:0005737) |
GO function: | rRNA methyltransferase activity (GO:0008649) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GidB