The domain within your query sequence starts at position 258 and ends at position 314; the E-value for the Glu_synthase domain shown below is 1.1e-6.
ASIDALREVVAAVNGKIEVYMDGGVRTGNDVLKALALGARCIFLGRPIIWGLACKGE
Glu_synthase |
 |
|---|
| PFAM accession number: | PF01645 |
|---|---|
| Interpro abstract (IPR002932): | Ferredoxin-dependent glutamate synthase (GltS) has been implicated in a number of functions including photorespiration in Arabidopsis where it may also play a role in primary nitrogen assimilation in roots [ (PUBMED:9596633) ]. GltS is a complex iron-sulfur flavoprotein that catalyzes the reductive synthesis of L-glutamate from 2-oxoglutarate and L-glutamine via intramolecular channelling of ammonia, a reaction in the plant, yeast and bacterial pathway for ammonia assimilation. It is a multifunctional enzyme that functions through three distinct active centres, carrying out L-glutamine hydrolysis, conversion of 2-oxoglutarate into L-glutamate, and electron uptake from an electron donor [ (PUBMED:15581577) (PUBMED:15052410) (PUBMED:12702341) ]. This domain is expressed as a separate subunit in the glutamate synthase alpha subunit from archaebacteria, or part of a large multidomain enzyme in other organisms. It contains a putative FMN binding site and Fe-S cluster [ (PUBMED:12455964) (PUBMED:8923741) ]. |
| GO process: | glutamate biosynthetic process (GO:0006537), oxidation-reduction process (GO:0055114) |
| GO function: | oxidoreductase activity, acting on the CH-NH2 group of donors (GO:0016638), glutamate synthase activity (GO:0015930) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glu_synthase