The domain within your query sequence starts at position 11 and ends at position 124; the E-value for the Glucosamine_iso domain shown below is 1.3e-12.
QASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTPLGCYQKLIEYYKNGDLSFQYVKTFN MDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAADLQAECDAFEEK
Glucosamine_iso |
 |
|---|
| PFAM accession number: | PF01182 |
|---|---|
| Interpro abstract (IPR006148): | This domain is characteristic of the enzymes 6-phosphogluconolactonase ( EC 3.1.1.31 ), Glucosamine-6-phosphate isomerase ( EC 3.5.99.6 ), and Galactosamine-6-phosphate isomerase. 6-Phosphogluconolactonase is the enzyme responsible for the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate, the second step in the pentose phosphate pathway. Glucosamine-6-phosphate isomerase (or Glucosamine 6-phosphate deaminase) is the enzyme responsible for the conversion of D-glucosamine 6-phosphate into D-fructose 6-phosphate [ (PUBMED:8747459) ]. It is the last specific step in the pathway for N-acetylglucosamine (GlcNAC) utilization in bacteria such as Escherichia coli (gene nagB) or in fungi such as Candida albicans (gene NAG1). |
| GO process: | carbohydrate metabolic process (GO:0005975) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glucosamine_iso